missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ PLA2G1B (Human) Recombinant Protein
Human PLA2G1B full-length ORF ( AAH05386, 17 a.a. - 70 a.a.) recombinant protein with GST-tag at N-terminal.
4515.00 SEK - 6845.00 SEK
Specifications
| Accession Number | AAH05386 |
|---|---|
| Gene ID (Entrez) | 5319 |
| Name | phospholipase A2, group IB (pancreas) |
| Preparation Method | Wheat germ expression system |
| Quality Control Testing | 125% SDS-PAGE Stained with Coomassie Blue |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16139151
|
Abnova™
H00005319-P01.10UG |
10 μg |
4515.00 SEK
10µg |
Estimated Shipment: 24-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
|
16149151
|
Abnova™
H00005319-P01.25UG |
25 μg |
6845.00 SEK
25µg |
Estimated Shipment: 24-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
- Sequence: SGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKQKQRV
Specifications
| AAH05386 | |
| phospholipase A2, group IB (pancreas) | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| MGC119834, MGC119835, PLA2, PLA2A, PPLA2 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
| 5319 | |
| Wheat germ expression system | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| PLA2G1B | |
| GST |