missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ PLXNA2 (Human) Recombinant Protein
Human PLXNA2 full-length ORF ( AAH32125, 1 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal.
4515.00 SEK - 6845.00 SEK
Specifications
| Accession Number | AAH32125 |
|---|---|
| Gene ID (Entrez) | 5362 |
| Name | plexin A2 |
| Preparation Method | Wheat germ expression system |
| Quality Control Testing | 125% SDS-PAGE Stained with Coomassie Blue |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16119231
|
Abnova™
H00005362-P01.10UG |
10 μg |
4515.00 SEK
10µg |
Estimated Shipment: 23-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
|
16129231
|
Abnova™
H00005362-P01.25UG |
25 μg |
6845.00 SEK
25µg |
Estimated Shipment: 23-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
- Sequence: MHSQVFSAFPYSLPLRFWVNVIKNPQFVFDIHKGSITDACLSVVAQTFMDSCSTSEHRLDKDSPSNKLLYAKDIPSYKSWVERYYADIAKLPAISDQDMNAYLAEQSRLHAVEFNMLSALNEIYSYVSKYSEELIGALEQDEQARRQRLAYKVEQLINAMSIES
Specifications
| AAH32125 | |
| plexin A2 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| FLJ11751, FLJ30634, KIAA0463, OCT, PLXN2 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
| 5362 | |
| Wheat germ expression system | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| PLXNA2 | |
| GST |