missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
Beskrivning
POLN Polyclonal specifically detects POLN in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifikationer
Specifikationer
| Antigen | POLN |
| Användningsområden | Immunocytochemistry, Immunofluorescence |
| Klassificering | Polyclonal |
| Konjugera | Unconjugated |
| Utspädning | Immunocytochemistry/Immunofluorescence 1-4 ug/ml |
| Formulering | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | DNA polymerase N, DNA polymerase nu, DNA polymerase POL4P, EC 2.7.7.7, POL4P, polymerase (DNA directed) nu |
| Gensymboler | POLN |
| Värd art | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FSTLTSQWKDVPVEQVTHADREQTKKVVYAVVYGAGKERLAACLGVPIQEAAQFLESFLQKYKKIKDFARAAIAQCHQTGCVVSIMGRRR |
| Visa mer |
For Research Use Only
Produkttitel
Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.
Hittar du en möjlighet till förbättring?