missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. POLN Antibody, Novus Biologicals™

POLN Antibody, Novus Biologicals™

Produktkod. 18253892 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
18253892 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18253892 Leverantör Novus Biologicals Leverantörsnummer NBP258779

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody

POLN Polyclonal specifically detects POLN in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen POLN
Användningsområden Immunocytochemistry, Immunofluorescence
Klassificering Polyclonal
Konjugera Unconjugated
Utspädning Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formulering PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias DNA polymerase N, DNA polymerase nu, DNA polymerase POL4P, EC 2.7.7.7, POL4P, polymerase (DNA directed) nu
Gensymboler POLN
Värd art Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FSTLTSQWKDVPVEQVTHADREQTKKVVYAVVYGAGKERLAACLGVPIQEAAQFLESFLQKYKKIKDFARAAIAQCHQTGCVVSIMGRRR
Reningsmetod Affinity Purified
Kvantitet 100 μL
Regulatorisk status RUO
Forskningsdisciplin DNA Repair
Primär eller sekundär Primary
Gen-ID (Entrez) 353497
Testspecificitet Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Målarter Human
Innehåll och lagring Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotyp IgG
Visa mer Visa mindre

For Research Use Only

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.