missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ POLR2D (Human) Recombinant Protein

Human POLR2D full-length ORF ( AAH17205, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00005433-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16179301

  • 3343.96 SEK / 10µg

Estimated Shipment: 09-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MAAGGSDPRAGDVEEDASQLIFPKGFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY
Specifications

Specifications

AAH17205
polymerase (RNA) II (DNA directed) polypeptide D
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
POLR2D
GST
5433
Wheat germ expression system
10 μg
HSRBP4, HSRPB4, RBP4
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates