missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PPAP2A Recombinant Protein

4515.00 SEK - 6845.00 SEK

Accession Number	AAH39847
For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gene ID (Entrez)	8611
Molecular Weight (g/mol)	56.98

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16162662 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00008611-P01.10UG	10 ug	4515.00 SEK 10µg View alternative products Save Up to »	Estimated Shipment: 29-05-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

16172662 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00008611-P01.25UG	25 ug	6845.00 SEK 25µg View alternative products Save Up to »	Estimated Shipment: 29-05-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number	AAH39847
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	56.98
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	PPAP2A
Cross Reactivity	Human
Recombinant	Recombinant
Form	Solution

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	8611
Name	PPAP2A (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAKYSIGRLRPHFLDVCDPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAILVAVYVSDFFKERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP
Gene Alias	LLP1a/LPP1/PAP-2a/PAP2/PAP2a2/PAP2alpha2/PAPalpha1
Gene Symbol	PPAP2A
Species	Wheat Germ (in vitro)
Protein Tag	GST

Description