missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PPARA (Human) Recombinant Protein

Name: Abnova&trade; PPARA (Human) Recombinant Protein
Brand: Abnova&trade;
SKU: 16119381
Price: 4515.00 EUR

Human PPARA full-length ORF ( AAH00052, 1 a.a. - 258 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00005465-P01.10ug

Additional Details : Weight : 0.00010kg

Product Code. 16119381

Estimated Shipment: 30-05-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGRSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPVGVCGCSGFSWQHGTSVVEDD

Specifications

Accession Number	AAH00052
Name	peroxisome proliferator-activated receptor alpha
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	PPARA
Protein Tag	GST

Gene ID (Entrez)	5465
Preparation Method	Wheat germ expression system
Quantity	10 μg
Gene Alias	MGC2237, MGC2452, NR1C1, PPAR, hPPAR
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Product Suggestions

Description