missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. PPIL2 Antibody, Novus Biologicals™

PPIL2 Antibody, Novus Biologicals™

Produktkod. 18222012 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
18222012 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18222012 Leverantör Novus Biologicals Leverantörsnummer NBP154366
 Begränsad artikel
Beräknad leverans: 02-12-2026
Lägg i varukorgen
Lägg i varukorgen

missing translation for 'validMainframeMsg'

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody

PPIL2 Polyclonal specifically detects PPIL2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot.
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen PPIL2
Användningsområden Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Klassificering Polyclonal
Koncentration 0.5 mg/ml
Konjugera Unconjugated
Utspädning Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Formulering PBS, 2% Sucrose with 0.09% Sodium Azide
Genaccessionsnr. Q13356
Gene Alias CYC4, cyclophilin, 60kDa, cyclophilin-60, Cyclophilin-like protein Cyp-60, Cyp-60, CYP60, EC 5.2.1.8, FLJ39930, hCyP-60, MGC33174, MGC787, peptidylprolyl cis-trans isomerase, peptidyl-prolyl cis-trans isomerase-like 2, peptidylprolyl isomerase (cyclophilin)-like 2, PPIase, Rotamase PPIL2
Gensymboler PPIL2
Värd art Rabbit
Immunogen Synthetic peptides corresponding to PPIL2(peptidylprolyl isomerase (cyclophilin)-like 2) The peptide sequence was selected from the C terminal of PPIL2. Peptide sequence GRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQ.
Molekylvikt av antigen 59 kDa
Reningsmetod Affinity purified
Kvantitet 100 μL
Regulatorisk status RUO
Primär eller sekundär Primary
Gen-ID (Entrez) 23759
Rekonstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Målarter Human
Innehåll och lagring Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Produkttyp Antibody
Isotyp IgG
Produktlinje Novus
Visa mer Visa mindre

For Research Use Only

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.