missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
Novus Biologicals™ Protein kinase-like protein SgK493 Recombinant Protein Antigen
Handla allt Bio Techne Produkter
Klicka för att se tillgängliga alternativ
Kvantitet:
0.1mL
Beskrivning
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PKDCC. Source: E.coli Amino Acid Sequence: STDCILEFPARNFTLPCSAQGWCEGMNEKRNLYNAYRFFFTYLLPHSAPPSLRPLLDSIVNATGELAWGVDETLAQLEKVLHLYRSGQ The Protein kinase-like protein SgK493 Recombinant Protein Antigen is derived from E. coli. The Protein kinase-like protein SgK493 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
This is a blocking peptide for NBP1-80756. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
Specifikationer
Specifikationer
| Gen-ID (Entrez) | 91461 |
| Art | Human |
| Reningsmetod | Chromatography |
| Renhet | >80% |
| Koncentration | 0.5mg/mL |
| Innehåll och lagring | Store at -20°C. Avoid freeze-thaw cycles. |
| Formulering | PBS and 1M Urea, pH 7.4. |
| För användning med (applikation) | Blocking/Neutralizing, Control |
| Gensymbol | PKDCC |
| Etiketttyp | Unlabeled |
| Visa mer |
For Research Use Only
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering