missing translation for 'onlineSavingsMsg'
Learn More

PSKH1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-17299-100UL

Product Code. 18322802

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

PSKH1 Polyclonal antibody specifically detects PSKH1 in Human samples. It is validated for Immunofluorescence

Specifications

Antigen	PSKH1
Classification	Polyclonal
Dilution	Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Gene Alias	EC 2.7.11, EC 2.7.11.1, protein serine kinase H1PSK-H1, serine/threonine-protein kinase H1
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: MGCGTSKVLPEPPKDVQLDLVKKVEPFSGTKSDVYKHFITEVDSVGPVKAG
Quantity	100 μg
Research Discipline	Protein Kinase
Gene ID (Entrez)	5681
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Product Suggestions

Description