missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PSMA1 (Human) Recombinant Protein

Human PSMA1 full-length ORF ( AAH02577, 1 a.a. - 263 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00005682-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16179751

  • 5030.41 SEK / 25µg

Estimated Shipment: 06-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH
Specifications

Specifications

AAH02577
proteasome (prosome, macropain) subunit, alpha type, 1
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PSMA1
GST
5682
Wheat germ expression system
25 μg
HC2, MGC14542, MGC14575, MGC14751, MGC1667, MGC21459, MGC22853, MGC23915, NU, PROS30
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates