missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PTCH1 (Human) Recombinant Protein

Human PTCH1 partial ORF (NP_000255.2, 651 a.a. - 750 a.a.) recombinant protein with GST tag at N-terminal.

Brand:  Abnova™ H00005727-Q02.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16183725

  • 5030.41 SEK / 25µg

Estimated Shipment: 03-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: AHETQITMQSTVQLRTEYDPHTHVYYTTAEPRSEISVQPVTVTQDTLSCQSPESTSSTRDLLSQFSDSSLHCLEPPCTKWTLSSFAEKHYAPFLLKPKAK
Specifications

Specifications

NP_000255.2
patched homolog 1 (Drosophila)
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PTCH1
GST
5727
Wheat germ expression system
25 μg
BCNS, FLJ26746, FLJ42602, HPE7, NBCCS, PTC, PTC1, PTCH, PTCH11
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates