missing translation for 'onlineSavingsMsg'
Läs mer

ARL13A, Rabbit, Polyclonal Antibody, Abnova™

Produktkod. 16105690
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Förpackningsstorlek:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet unitSize
16105690 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 16105690 Leverantör Abnova Leverantörsnummer PAB23102.100uL

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Rabbit polyclonal antibody raised against recombinant ARL13A.

Sequence: EETRRNVTIPIIGLNNSGKTVLVEAFQKLLPSKTDHCMKSELTTLLLDEYELSIYDLNGDLKGREAWPNYYAQAHGLVFVLDS

Specifikationer

Antigen ARL13A
Användningsområden Immunohistochemistry (PFA fixed)
Klassificering Polyclonal
Konjugera Unconjugated
Beskrivning Rabbit polyclonal antibody raised against recombinant ARL13A.
Utspädning Immunohistochemistry (1:20-1:50) The optimal working dilution should be determined by the end user.
Formulering In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gen ARL13A
Genaccessionsnr. Q5H913
Gene Alias ARL13/dJ341D10.2
Gensymboler ARL13A
Värd art Rabbit
Immunogen Recombinant protein corresponding to amino acids of human ARL13A.
Reningsmetod Antigen affinity purification
Kvantitet 100 μL
Regulatorisk status RUO
Primär eller sekundär Primary
Gen-ID (Entrez) 392509
Målarter Human
Innehåll och lagring Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Form Liquid
Isotyp IgG
Visa mer Visa mindre

For Research Use Only

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.