missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
EPC2, Rabbit, Polyclonal Antibody, Abnova™
Beskrivning
Sequence: YATPATLHNGNHHKVQECKTKHPHHLSLKEEASDVVRQKKKYPKKPKAEALITSQQPTPETLPVINKSDIKQYDFHSSDEDEFPQVLS
Specifikationer
Specifikationer
| Antigen | EPC2 |
| Användningsområden | Immunohistochemistry (PFA fixed) |
| Klassificering | Polyclonal |
| Konjugera | Unconjugated |
| Beskrivning | Rabbit polyclonal antibody raised against recombinant EPC2. |
| Utspädning | Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user. |
| Formulering | In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide) |
| Gen | EPC2 |
| Genaccessionsnr. | Q52LR7 |
| Gene Alias | DKFZp566F2124/EPC-LIKE |
| Visa mer |
For Research Use Only
Produkttitel
Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.
Hittar du en möjlighet till förbättring?