missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. 16104340

SETD1B Rabbit anti-Human, Polyclonal Antibody, Abnova™

Produktkod. 16104340
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Förpackningsstorlek:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet unitSize
16104340 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 16104340 Leverantör Abnova Leverantörsnummer PAB21443.100uL

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit polyclonal antibody raised against recombinant SETD1B.

SET1B is a component of a histone methyltransferase complex that produces trimethylated histone H3 at Lys4 (Lee et al., 2007 [PubMed 17355966]).[supplied by OMIM

Sequence: DSLGMEEEVDIETEAVAPEERPSMLDEPPLPVGVEEPADSREPPEEPGLSQEGAMLLSPEPPAKEVEARPPLSPER

Specifikationer

Antigen SETD1B
Användningsområden Immunofluorescence, Immunohistochemistry (PFA fixed)
Klassificering Polyclonal
Konjugera Unconjugated
Beskrivning Rabbit polyclonal antibody raised against recombinant SETD1B.
Utspädning Immunohistochemistry (1:50-1:200) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
Formulering In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gen SETD1B
Gene Alias FLJ20803/KIAA1076/KMT2G/Set1B
Gensymboler SETD1B
Värd art Rabbit
Immunogen Recombinant protein corresponding to amino acids of human SETD1B.
Reningsmetod Antigen affinity purification
Kvantitet 100 μL
Regulatorisk status RUO
Primär eller sekundär Primary
Gen-ID (Entrez) 23067
Målarter Human
Innehåll och lagring Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Form Liquid
Isotyp IgG
Visa mer Visa mindre

For Research Use Only

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.