missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. 16103530

SFRS11, Rabbit, Polyclonal Antibody, Abnova™

Produktkod. 16103530
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Förpackningsstorlek:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet unitSize
16103530 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 16103530 Leverantör Abnova Leverantörsnummer PAB20446.100uL

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit polyclonal antibody raised against recombinant SFRS11.

This gene encodes 54kDa nuclear protein that contains an arginine/serine-rich region similar to segments found in pre-mRNA splicing factors. Although the function of this protein is not yet known, structure and immunolocalization data suggest that it may play a role in pre-mRNA processing. [provided by RefSeq

Sequence: LLPTPNPLTQIGAVPLAALGAPTLDPALAALGLPGANLNSQSLAADQLLKLMSTVDPKLNHVAAGLVSPSLKSDTSSKEIEEAMKRVREAQSLISAAIEPDKKEEKRRHSRSRSR

Specifikationer

Antigen SFRS11
Användningsområden Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Klassificering Polyclonal
Konjugera Unconjugated
Beskrivning Rabbit polyclonal antibody raised against recombinant SFRS11.
Utspädning Immunohistochemistry (1:200-1:500) Western Blot (1:250-1:500) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
Formulering In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gen SFRS11
Gene Alias DKFZp686M13204/dJ677H15.2/p54
Gensymboler SFRS11
Värd art Rabbit
Immunogen Recombinant protein corresponding to amino acids of human SFRS11.
Reningsmetod Antigen affinity purification
Kvantitet 100 μL
Regulatorisk status RUO
Primär eller sekundär Primary
Gen-ID (Entrez) 9295
Målarter Human
Innehåll och lagring Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Form Liquid
Isotyp IgG
Visa mer Visa mindre

For Research Use Only

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.