missing translation for 'onlineSavingsMsg'
Learn More

TBC1D12 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Name: TBC1D12 Rabbit anti-Human, Polyclonal Antibody, Abnova&trade;
Brand: Abnova
SKU: 16105870
Price: 6615.00 EUR

Rabbit polyclonal antibody raised against recombinant TBC1D12.

Brand: Abnova PAB23322.100uL

Additional Details : Weight : 0.02000kg

Product Code. 16105870

Estimated Shipment: 14-06-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: MVGPEDAGACSGRNPKLLPVPAPDPVGQDRKVIRATGGFGGGVGAVEPPEEADEEE

Specifications

Antigen	TBC1D12
Classification	Polyclonal
Description	Rabbit polyclonal antibody raised against recombinant TBC1D12.
Formulation	In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene Alias	FLJ10339/FLJ12820/KIAA0608
Host Species	Rabbit
Purification Method	Antigen affinity purification
Regulatory Status	RUO
Gene ID (Entrez)	23232
Content And Storage	Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG

Applications	Immunohistochemistry (PFA fixed)
Conjugate	Unconjugated
Dilution	Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.
Gene	TBC1D12
Gene Symbols	TBC1D12
Immunogen	Recombinant protein corresponding to amino acids of human TBC1D12.
Quantity	100 μL
Primary or Secondary	Primary
Target Species	Human
Form	Liquid

Product Suggestions

For Research Use Only

Description