missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. 16044527

TCHHL1, Rabbit, Polyclonal Antibody, Abnova™

Produktkod. 16044527
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Förpackningsstorlek:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet unitSize
16044527 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 16044527 Leverantör Abnova Leverantörsnummer PAB23957.100uL

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit polyclonal antibody raised against recombinant TCHHL1.

Sequence: KHSNIQEPPLQREDEPSSQHADLPEQAAARSPSQTQKSTDSKDVCRMFDTQEPGKDADQTPAKTKNLGEPEDYGRTSETQEKECETKDLPVQYGSRN

Specifikationer

Antigen TCHHL1
Användningsområden Immunohistochemistry (PFA fixed)
Klassificering Polyclonal
Konjugera Unconjugated
Beskrivning Rabbit polyclonal antibody raised against recombinant TCHHL1.
Utspädning Immunohistochemistry (1:500-1:1000) The optimal working dilution should be determined by the end user.
Formulering In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gen TCHHL1
Gene Alias S100A17/THHL1/basalin
Gensymboler TCHHL1
Värd art Rabbit
Immunogen Recombinant protein corresponding to amino acids of human TCHHL1.
Reningsmetod Antigen affinity purification
Kvantitet 100 μL
Regulatorisk status RUO
Primär eller sekundär Primary
Gen-ID (Entrez) 126637
Målarter Human
Innehåll och lagring Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Form Liquid
Isotyp IgG
Visa mer Visa mindre

For Research Use Only

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.