missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant HIV-2 gp-36 397aa Protein

Name: enQuireBio&trade; Recombinant HIV-2 gp-36 397aa Protein
Brand: enQuireBio&trade;
SKU: 15999888
Price: 20560.00 EUR

A cDNA sequence encoding the HIV-2 gp-36 397aa was constructed and used to recombinantly synthesize the protein.

Brand: enQuireBio™ QP12270-1mg

Additional Details : Weight : 0.01000kg

Product Code. 15999888

Estimated Shipment: 05-06-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Specifications

Name	HIV-2 gp-36 397aa Protein
Regulatory Status	Research Use Only
Product Type	Recombinant Protein
Species	E. coli
Sequence	EQTMVQDDPSTCRGEFLYCNMTWFLNWIENKTHRNYAPCHIKQIINTWHKVGRNVYLPPREGELSCNSTVTSIIANIDWQNNNQTNITFSAEVAELYRLELGDYKLVEITPIGFAPTKEKRYSSAHGRHTRGVFVLGFLGFLATAGSAMGAASLTVSAQSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQARVTAIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDSLAPDWDNMTWQEWEKQVRYLEANISKSLEQAQIQQEKNMYELQKLNSWDIFGNWFDLTSWVKYIQYGVLIIVAVIALRIVIYVVQMLSRLRKGYRPVFSSPPGYIQQIHIHKDRGQPANEETEEDGGSNGGDRYWPWPIAYIHFLIRQLIRLLTRLYSICSQAC
Purity or Quality Grade	Greater than 95.0% as determined by HPLC analysis and SDS-PAGE.

Quantity	1 mg
Endotoxin Concentration	Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Cross Reactivity	HIV
Protein Tag	Untagged
Buffer	0.01M Na2CO3, 0.01M Na3EDTA, 0.014 Mb-mercaptoethanol, 0.05% Tween-20.

Product Suggestions

Description