missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant HPV HPV 6 Protein
A cDNA sequence encoding the HPV 6 was constructed and used to recombinantly synthesize the protein.
2690.00 SEK - 20560.00 SEK
Specifications
Name | HPV HPV 6 Protein |
---|---|
Regulatory Status | Research Use Only |
Endotoxin Concentration | Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. |
Product Type | Recombinant Protein |
Cross Reactivity | HPV |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
15950009
|
enQuireBio™
QP12309-100UG |
100 μg |
2690.00 SEK
100µg |
Estimated Shipment: 07-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15970009
|
enQuireBio™
QP12309-500UG |
500 μg |
10265.00 SEK
500µg |
Estimated Shipment: 07-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15960009
|
enQuireBio™
QP12309-1MG |
1 mg |
20560.00 SEK
1mg |
Estimated Shipment: 07-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Specifications
HPV HPV 6 Protein | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
HPV | |
GST | |
PBS and 3M Urea. |
Research Use Only | |
Recombinant Protein | |
E. coli | |
VDVPPPNPVSKVVATDAYVTRTNIFYHASSSRLLAVGHPYFSIKRANKTVVPKVSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGLEVGRGQPLGVGVSGHPFLNKYDDVENSGSGGNPGQDNRVNVGMDYKQTQLCMVGCAPPLGEHWGKGKQCTNTPVQAGDCPPLELITSVIQDGDMVDTGFGAMNFADLQTNKSDVPIDICGTTCKYPDYLQMAADPYGDRLFFFLRKEQMFARHFFNRAGEVGEPVPDTLIIKGSGNRTSVGSSIYVNTPSGSLVSSEAQLFNKPYWLQKAQGHNNGICWGNQLFVTVVDTTRSTNMTLCASVTTSSTYTNSDYKEYMRHVEEYDLQFIFQLCSITLSAEVMAYIHTMNPSVLEDWNFGLSPPPNGTLEDTYRYVQSQAITCQKPTPEKEKPDPYKNLSFWEVNLKEKFSSELDQYPLGRKFLLQSGYRGRSSIRTGVKRPAVSKASAAPKRKRAK | |
Protein is >95% pure as determined by 10% PAGE (coomassie staining). |