missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Human GNLY Protein
A cDNA sequence encoding the GNLY was constructed and used to recombinantly synthesize the protein.
Brand: enQuireBio™ QP12021-1mg
Additional Details : Weight : 0.01000kg
Specifications
| GNLY Protein | |
| Research Use Only | |
| Recombinant Protein | |
| E. coli | |
| MGSSHHHHHHSSGLVPRGSHMMEGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPLGSHHHHHH | |
| Greater than 95.0% as determined by SDS-PAGE. |
| 1 mg | |
| Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
| Human | |
| His | |
| The Granulysin protein was lyophilized from a concentrated (1 mg/ml) solution containing no additives. |