missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Human GNLY Protein
A cDNA sequence encoding the GNLY was constructed and used to recombinantly synthesize the protein.
Brand: enQuireBio™ QP12021-2ug
Additional Details : Weight : 0.01000kg
Specifications
GNLY Protein | |
2 μg | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
Human | |
His | |
The Granulysin protein was lyophilized from a concentrated (1 mg/ml) solution containing no additives. |
Greater than 95.0% as determined by SDS-PAGE. | |
Research Use Only | |
Recombinant Protein | |
E. coli | |
MGSSHHHHHHSSGLVPRGSHMMEGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPLGSHHHHHH |