missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Rat CNTF Protein

A cDNA sequence encoding the CNTF was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP10559-5ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15934248

  • 1245.00 SEK / 5µg
Estimated Shipment: 19-01-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Specifications

Specifications

CNTF Protein
5 μg
< 1.0 EU per ug protein as determined by the LAL method.
Recombinant Protein
E. coli
AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
Greater than 99.0% as determined by:(a) Analysis by Gel Filtration. (b) Analysis by SDS-PAGE.
Research Use Only
Fully biologically active by its ability to phosphorylate STAT3 in several cells lines.
Rat
Untagged
Lyophilized from a concentrated (1 mg/ml) solution in water containing 0.025% NaHCO3.
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers