missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. RFTN2 Antibody - Azide and BSA Free, Novus Biologicals™

RFTN2 Antibody - Azide and BSA Free, Novus Biologicals™

Produktkod. 18626180 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
0.02 mL
0.1 mL
Förpackningsstorlek:
0.1ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet unitSize
18626180 0.02 mL -
18639650 0.1 mL 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18626180 Leverantör Novus Biologicals Leverantörsnummer NBP2932910.02ml

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 Se alternativa produkter

Denna artikel kan inte returneras. Se returpolicy

Description

Rabbit Polyclonal Antibody

RFTN2 Polyclonal antibody specifically detects RFTN2 in Human, Mouse, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen RFTN2
Användningsområden Western Blot
Klassificering Polyclonal
Konjugera Unconjugated
Utspädning Western Blot 1:500-1:2000
Formulering PBS (pH 7.3), 50% glycerol
Gene Alias C2orf11, chromosome 2 open reading frame 11, FLJ30574, MGC117313, raftlin family member 2, raftlin-2, Raft-linking protein 2
Värd art Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 412-501 of human RFTN2 (NP_653230.2). KKASRHIKGEDKNKATSRSIGLDTTSSQPAESRHLPEECRLSPSRECWTKEGRLAQHNSFSGFSSSDNVLRELDDGQFDQEDGVTQVTCM
Reningsmetod Affinity purified
Kvantitet 0.02 mL
Regulatorisk status RUO
Forskningsdisciplin Cell Biology
Primär eller sekundär Primary
Gen-ID (Entrez) 130132
Målarter Human, Mouse, Rat
Innehåll och lagring Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotyp IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.