missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. RhoB Antibody - Azide and BSA Free, Novus Biologicals™

RhoB Antibody - Azide and BSA Free, Novus Biologicals™

Produktkod. 18621222 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
0.02 mL
0.1 mL
Förpackningsstorlek:
0.1ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet Förpackningsstorlek
18621222 0.02 mL -
18649551 0.1 mL 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18621222 Leverantör Novus Biologicals Leverantörsnummer NBP2941040.02ml
 Begränsad artikel
Beräknad leverans: 02-12-2026
Lägg i varukorgen
Lägg i varukorgen

missing translation for 'validMainframeMsg'

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody

RhoB Polyclonal specifically detects RhoB in Human, Mouse, Rat samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen RhoB
Användningsområden Western Blot
Klassificering Polyclonal
Konjugera Unconjugated
Utspädning Western Blot 1:500 - 1:1000
Formulering PBS (pH 7.3), 50% glycerol
Gene Alias ARH6MSTP081, ARHBAplysia RAS-related homolog 6, h6, MST081, oncogene RHO H6, ras homolog gene family, member B, Rho cDNA clone 6, RHOH6RhoB, rho-related GTP-binding protein RhoB
Värd art Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-190 of human RhoB (NP_004031.1). VPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCI
Reningsmetod Affinity purified
Kvantitet 0.02 mL
Regulatorisk status RUO
Forskningsdisciplin Angiogenesis
Primär eller sekundär Primary
Gen-ID (Entrez) 388
Målarter Human, Mouse, Rat
Innehåll och lagring Store at -20°C. Avoid freeze-thaw cycles.
Produkttyp Antibody
Form Purified
Isotyp IgG
Produktlinje Novus
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.