missing translation for 'onlineSavingsMsg'
Läs mer

RNASE7, Mouse anti-Human, Clone: CL0224, Abnova™

Produktkod. 16089869
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Förpackningsstorlek:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet unitSize
16089869 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 16089869 Leverantör Abnova Leverantörsnummer MAB15568.100uL

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Mouse Monoclonal Antibody

Sequence: KGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKNCHQSHGPVSLTMCKLTSGKYPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPVHLDRV

Specifikationer

Antigen RNASE7
Användningsområden Immunohistochemistry (Paraffin), Western Blot
Klassificering Monoclonal
Klona CL0224
Konjugera Unconjugated
Utspädning Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) Western Blot (1:500-1:1000) The optimal working dilution should be determined by the end user.
Formulering In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gen ribonuclease, RNase A family, 7
Gene Alias MGC133220
Gensymboler RNASE7
Värd art Mouse
Immunogen Recombinant protein corresponding to human RNASE7.
Kvantitet 100 μL
Regulatorisk status RUO
Primär eller sekundär Primary
Gen-ID (Entrez) 84659
Målarter Human
Innehåll och lagring Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Produkttyp Antibody
Form Liquid
Isotyp IgG2a
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.