missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ SCGB2A2 (Human) Recombinant Protein

Human SCGB2A2 full-length ORF ( AAI28403.1, 1 a.a. - 93 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00004250-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16177791

  • 5030.41 SEK / 25µg

Estimated Shipment: 08-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF
Specifications

Specifications

AAI28403.1
secretoglobin, family 2A, member 2
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
SCGB2A2
GST
4250
Wheat germ expression system
25 μg
MGB1, MGC71974, UGB2
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates