missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
SCP3/SYCP3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-54713
Denna artikel kan inte returneras.
Se returpolicy
Beskrivning
SCP3/SYCP3 Polyclonal specifically detects SCP3/SYCP3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifikationer
| SCP3/SYCP3 | |
| Polyclonal | |
| Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| MGC71888, SCP3, SCP-3, SCP3 chromosome 3 open reading frame 8, SCP3 COR1, synaptonemal complex protein 3 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| SYCP3 | |
| This antibody was developed against a Recombinant Protein corresponding to amino acids:KYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSAGVVEDMGGEVQNMLEGV | |
| 100 μL | |
| Cell Biology, Cell Cycle and Replication, Chromatin Research, Growth and Development, Neuronal Cell Markers, Neuroscience, Neurotransmission | |
| 50511 | |
| Human | |
| IgG |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering