missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
SDHD Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-92372
Denna artikel kan inte returneras.
Se returpolicy
Beskrivning
SDHD Polyclonal specifically detects SDHD in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifikationer
| SDHD | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20-1:50 | |
| O14521 | |
| SDHD | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:RTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASLHW | |
| 0.1 mL | |
| Core ESC Like Genes, Stem Cell Markers | |
| 6392 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CBT1, CII-4, CybS, PGL, PGL1, QPs3, SDH4, succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial, Succinate dehydrogenase complex subunit D, succinate dehydrogenase complex, subunit D, integral membrane protein, succinate dehydrogenase ubiquinone cytochrome B small subunit, Succinate-ubiquinone oxidoreductase cytochrome b small subunit, Succinate-ubiquinone reductase membrane anchor subunit | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering