missing translation for 'onlineSavingsMsg'
Learn More

Segmentation protein paired Rabbit anti-Drosophila, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-09255-100UL

Product Code. 18323635

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Segmentation protein paired Polyclonal specifically detects Segmentation protein paired in Drosophila samples. It is validated for Western Blot.

Specifications

Antigen	Segmentation protein paired
Classification	Polyclonal
Dilution	Western Blot 1.0 ug/ml
Gene Alias	PRD
Immunogen	The immunogen is a synthetic peptide corresponding to a region of Fruit fly (NP_723721). Peptide sequence MTVTAFAAAMHRPFFNGYSTMQDMNSGQGRVNQLGGVFINGRPLPNNIRL
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Drosophila
Form	Purified

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS buffer, 2% sucrose
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	34629
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Description