missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
Beskrivning
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRSS23. Source: E.coli Amino Acid Sequence: PWKPTWPAYRLPVVLPQSTLNLAKPDFGAEAKLEVSSSCGPQCHKGTPLPTYEEAKQYLSYETLYANGSRTETQVGIYILSSSGDGA The Serine protease 23 Recombinant Protein Antigen is derived from E. coli. The Serine protease 23 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
This is a blocking peptide for NBP1-80748. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
Specifikationer
Specifikationer
| Gen-ID (Entrez) | 11098 |
| Art | Human |
| Reningsmetod | Chromatography |
| Renhet | >80% |
| Koncentration | 0.5mg/mL |
| Innehåll och lagring | Store at -20°C. Avoid freeze-thaw cycles. |
| Formulering | PBS and 1M Urea, pH 7.4. |
| För användning med (applikation) | Blocking/Neutralizing, Control |
| Gensymbol | PRSS23 |
| Etiketttyp | Unlabeled |
| Visa mer |
For Research Use Only
Produkttitel
Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.
Hittar du en möjlighet till förbättring?