missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ SFN (Human) Recombinant Protein

Human SFN full-length ORF ( AAH00329.1, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00002810-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16185631

  • 3343.96 SEK / 10µg

Estimated Shipment: 14-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKAETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS
Specifications

Specifications

AAH00329.1
stratifin
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
SFN
GST
2810
Wheat germ expression system
10 μg
YWHAS
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates