missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. SLC38A3 Antibody - Azide and BSA Free, Novus Biologicals™

SLC38A3 Antibody - Azide and BSA Free, Novus Biologicals™

Produktkod. 18620691 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
0.02 mL
0.1 mL
Förpackningsstorlek:
0.1ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet Förpackningsstorlek
18620691 0.02 mL -
18686580 0.1 mL 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18620691 Leverantör Novus Biologicals Leverantörsnummer NBP2931430.02ml

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 Se alternativa produkter

missing translation for 'validMainframeMsg'

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody

SLC38A3 Polyclonal antibody specifically detects SLC38A3 in Human, Mouse, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen SLC38A3
Användningsområden Western Blot
Klassificering Polyclonal
Konjugera Unconjugated
Utspädning Western Blot 1:500-1:2000
Formulering PBS (pH 7.3), 50% glycerol
Gene Alias G17sodium-coupled neutral amino acid transporter 3, Na(+)-coupled neutral amino acid transporter 3, NAT1, N-system amino acid transporter 1, SN1system N1 Na+ and H+-coupled glutamine transporter, SNAT3, Solute carrier family 38 member 3, solute carrier family 38, member 3, System N amino acid transporter 1
Värd art Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human SLC38A3 (NP_006832.1). MEAPLQTEMVELVPNGKHSEGLLPVITPMAGNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGK
Reningsmetod Affinity purified
Kvantitet 0.02 mL
Regulatorisk status RUO
Forskningsdisciplin Amino Acids Drugs and other small molecules, Endocrinology, Signal Transduction
Primär eller sekundär Primary
Gen-ID (Entrez) 10991
Målarter Human, Mouse, Rat
Innehåll och lagring Store at -20°C. Avoid freeze-thaw cycles.
Produkttyp Antibody
Form Purified
Isotyp IgG
Produktlinje Novus
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.