missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. SLCO6A1 Antibody - Azide and BSA Free, R&D Systems™

SLCO6A1 Antibody - Azide and BSA Free, R&D Systems™

Product Code. 18613752 Shop All Bio Techne Products
Change view
Click to view available options
Kvantitet:
0.02 mL
0.1 mL
Unit Size:
0.1ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Kvantitet Unit Size
18613752 0.1 mL 0.1ml
18676382 0.02 mL -
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18613752 Supplier Novus Biologicals Supplier No. NBP2951320.1ml
 Begränsad artikel
Beräknad leverans: 03-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

SLCO6A1 Polyclonal specifically detects SLCO6A1 in Human, Mouse, Rat samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen SLCO6A1
Användningsområden Western Blot
Klassificering Polyclonal
Konjugera Unconjugated
Utspädning Western Blot 1:500-1:2000
Formulering PBS (pH 7.3), 50% glycerol
Gene Alias Cancer/testis antigen 48, CT48Organic anion-transporting polypeptide I, Gonad-specific transporter, GSTOATP-I, MGC26949, OATP6A1Solute carrier family 21 member 19, OATPY, Organic anion-transporting polypeptide 6A1, SLC21A19, solute carrier organic anion transporter family member 6A1, solute carrier organic anion transporter family, member 6A1, testis-specific organic anion transporter
Värd art Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 480-580 of human SLCO6A1 (NP_775759.3). VQFAGINEDYDGTGKLGNLTAPCNEKCRCSSSIYSSICGRDDIEYFSPCFAGCTYSKAQNQKKMYYNCSCIKEGLITADAEGDFIDARPGKCDAKCYKLPL
Reningsmetod Affinity purified
Kvantitet 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Cancer, Endocrinology, Signal Transduction
Primär eller sekundär Primary
Gen-ID (Entrez) 133482
Målarter Human, Mouse, Rat
Innehåll och lagring Store at -20°C. Avoid freeze-thaw cycles.
Produkttyp Antibody
Form Purified
Isotyp IgG
Produktlinje Novus
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.