missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. SLU7 Antibody, R&D Systems™

SLU7 Antibody, R&D Systems™

Produktkod. 18602807 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
18602807 25 μL
18200165 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18602807 Leverantör Novus Biologicals Leverantörsnummer NBP25866525ul
  • ONLINE EXCLUSIVE PRICE
    4441.54 SEK
    3748.50 SEK / 25µL
    Save 693.04 SEK
    15% Av
 Begränsad artikel
Beräknad leverans: 02-12-2026
Zum Warenkorb hinzufügen
Zum Warenkorb hinzufügen

missing translation for 'validMainframeMsg'

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

SLU7 Polyclonal specifically detects SLU7 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen SLU7
Användningsområden Immunocytochemistry, Immunofluorescence
Klassificering Polyclonal
Konjugera Unconjugated
Utspädning Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formulering PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
Gene Alias hSlu7, MGC9280, pre-mRNA-splicing factor SLU7,9G8, SLU7 splicing factor homolog (S. cerevisiae), splicing factor, step II splicing factor SLU7, zinc knuckle motif containing
Gensymboler SLU7
Värd art Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YSRHGTVIKGQERAVACSKYEEDVKIHNHTHIWGSYWKEGRWGYKCCHSFFKYSYCTGEAGKEIVNSEECIINEITGEESVKKPQTLMELHQ
Reningsmetod Affinity Purified
Kvantitet 25 μL
Regulatorisk status RUO
Primär eller sekundär Primary
Gen-ID (Entrez) 10569
Testspecificitet Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Målarter Human
Innehåll och lagring Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Produkttyp Antibody
Isotyp IgG
Produktlinje Novus
Mehr anzeigen Weniger anzeigen

For Research Use Only

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.