missing translation for 'onlineSavingsMsg'
Learn More

Sorting Nexin 31 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-10155-100UL

Product Code. 18323625

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Sorting Nexin 31 Polyclonal specifically detects Sorting Nexin 31 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen	Sorting Nexin 31
Classification	Polyclonal
Dilution	Western Blot 1.0 ug/ml
Gene Alias	MGC39715, sorting nexin 31, sorting nexin-31
Immunogen	The immunogen is a synthetic peptide directed towards the middle terminal region of mouse Sorting Nexin 31 (NP_079988.3). Peptide sequence QIQDIAFQMSRVKCWQVTFLGTLLDTDGPQRTLNQNLELRFQYSEDSCQQ
Quantity	100 μg
Research Discipline	Signal Transduction
Gene ID (Entrez)	169166
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Description