missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Sorting Nexin 31 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-10155-100UL
This item is not returnable.
View return policy
Description
Sorting Nexin 31 Polyclonal specifically detects Sorting Nexin 31 in Mouse samples. It is validated for Western Blot.Specifications
Sorting Nexin 31 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
MGC39715, sorting nexin 31, sorting nexin-31 | |
The immunogen is a synthetic peptide directed towards the middle terminal region of mouse Sorting Nexin 31 (NP_079988.3). Peptide sequence QIQDIAFQMSRVKCWQVTFLGTLLDTDGPQRTLNQNLELRFQYSEDSCQQ | |
100 μg | |
Signal Transduction | |
169166 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Mouse | |
Purified |