missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. 18230582

SV2A Antibody, Novus Biologicals™

Produktkod. 18230582 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
18230582 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18230582 Leverantör Novus Biologicals Leverantörsnummer NBP159666100UL

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody

SV2A Polyclonal specifically detects SV2A in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen SV2A
Användningsområden Western Blot
Klassificering Polyclonal
Konjugera Unconjugated
Utspädning Western Blot 1:100-1:2000
Formulering PBS and 2% Sucrose with 0.09% Sodium Azide
Genaccessionsnr. Q7L0J3
Gene Alias KIAA0736SV2, synaptic vesicle glycoprotein 2A
Gensymboler SV2A
Värd art Rabbit
Immunogen Synthetic peptides corresponding to SV2A(synaptic vesicle glycoprotein 2A) The peptide sequence was selected from the middle region of SV2A. Peptide sequence LENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCT.
Molekylvikt av antigen 83 kDa
Reningsmetod Affinity Purified
Kvantitet 100 μL
Primär eller sekundär Primary
Gen-ID (Entrez) 9900
Målarter Human
Innehåll och lagring Store at -20C. Avoid freeze-thaw cycles.
Isotyp IgG
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.