missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TEKT1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-09258-100UL
This item is not returnable.
View return policy
Description
TEKT1 Polyclonal specifically detects TEKT1 in Mouse samples. It is validated for Western Blot.Specifications
TEKT1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
tektin 1, tektin-1 | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse TEKT1 (NP_035699). Peptide sequence EEWYIANKSQYHRAEAQRSQSERLVAESQRLVEEIEKTTRKSQSDVNKKL | |
100 μg | |
Primary | |
Mouse | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
83659 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |