missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
Beskrivning
TEX12 Polyclonal specifically detects TEX12 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifikationer
Specifikationer
| Antigen | TEX12 |
| Användningsområden | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassificering | Polyclonal |
| Konjugera | Unconjugated |
| Utspädning | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Formulering | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | testis expressed 12, testis expressed sequence 12, testis-expressed sequence 12 protein, testis-expressed sequence 12 protein variant 2, testis-expressed sequence 12 protein variant 3 |
| Gensymboler | TEX12 |
| Värd art | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SKEINLMLSTYAKLLSERAAVDASYIDEIDELFKEANAIENFLIQKREFLRQRFTVIANTLHR |
| Visa mer |
For Research Use Only
Produkttitel
Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.
Hittar du en möjlighet till förbättring?