Läs mer
Invitrogen™ TIMP3 Polyclonal Antibody

Rabbit Polyclonal Antibody
Brand: Invitrogen™ PA595446
Beskrivning
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat kidney tissue, NIH3T3 whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Tissue inhibitor of metalloproteinase 3 (TIMP3) is a member of the tissue inhibitor of metalloproteinases gene family. It functions to inhibit the activity of matrix metalloproteinases (MMP) which degrade components of the extracellular matrix. TIMP3 is expressed upon mitogenic stimulation. It binds irreversibly to zinc-dependent MMPs and inactivates them by binding to their catalytic zinc cofactor. Other functions of TIMP3 include nervous system development, tissue regeneration, and visual perception. In humans, the gene encoding TIMP3 is located on chromosome 22.
Specifikationer
| TIMP3 | |
| Polyclonal | |
| Unconjugated | |
| TIMP3 | |
| HSMRK222; K222; K222TA2; Metalloproteinase inhibitor 3; MIG-5 protein; protein MIG-5; SFD; Sun; TIMP 3; TIMP metallopeptidase inhibitor 3; TIMP metallopeptidase inhibitor 3 (Sorsby fundus dystrophy, pseudoinflammatory); TIMP metallopeptidase inhibitor 3 L homeolog; timp3; TIMP-3; TIMP-3 protein; timp3.L; timp3-A; tissue inhibitor metalloproteinase-3; tissue inhibitor of metalloproteinase 3; tissue inhibitor of metalloproteinase 3 (Sorsby fundus dystrophy, pseudoinflammatory); tissue inhibitor of metalloproteinase-3; tissue inhibitor of metalloproteinase-3 precursor; tissue inhibitor of metalloproteinases 3; tissue inhibitor of metalloproteinases-3; XELAEV_18002484mg | |
| Rabbit | |
| Affinity chromatography | |
| RUO | |
| 21859, 25358, 7078 | |
| -20°C | |
| Lyophilized |
| ELISA, Western Blot | |
| 500 μg/mL | |
| PBS with 4mg trehalose and 0.05mg sodium azide | |
| P35625, P39876, P48032 | |
| TIMP3 | |
| A synthetic peptide corresponding to a sequence in the middle region of human TIMP3 (107-141aa RVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHL). | |
| 100 μg | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.