missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ TNNC2 Recombinant Protein

Human TNNC2 full-length ORF (AAH05323, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal

Brand:  Abnova™ H00007125-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16131472

  • 6150.00 SEK / 25µg
Estimated Shipment: 03-10-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Troponin (Tn), a key protein complex in the regulation of striated muscle contraction, is composed of 3 subunits. The Tn-I subunit inhibits actomyosin ATPase, the Tn-T subunit binds tropomyosin and Tn-C, while the Tn-C subunit binds calcium and overcomes the inhibitory action of the troponin complex on actin filaments. The protein encoded by this gene is the Tn-C subunit.

  • Troponin C type 2 (fast)
  • Molecular weight: 43.34kDa
  • Preparation method: in vitro wheat germ expression system
  • Purification: Glutathione Sepharose 4 Fast Flow
  • Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH 8 in the elution buffer
  • Quality Control Testing: 12.5% SDS-PAGE stained with Coomassie Blue

Sequence:
MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ

Best use within three months from the date of receipt of this protein.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Specifications

AAH05323
Solution
7125
TNNC2 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
TNNC2
Wheat Germ (in vitro)
GST
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
43.34
8
Glutathione Sepharose 4 Fast Flow
25 ug
MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ
TNNC2
Human
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers