missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ TNPO1 (Human) Recombinant Protein
Human TNPO1 partial ORF ( NP_002261, 25 a.a. - 141 a.a.) recombinant protein with GST-tag at N-terminal.
Brand: Abnova™ H00003842-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
- Sequence: PDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSEDEPTRSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVGILITTIASKGELQNWPDLLPKLCSLLDSED
Specifications
| NP_002261 | |
| transportin 1 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| TNPO1 | |
| GST |
| 3842 | |
| Wheat germ expression system | |
| 10 μg | |
| IPO2, KPNB2, MIP, MIP1, TRN | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |