missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. TOMM6 Antibody, Novus Biologicals™

TOMM6 Antibody, Novus Biologicals™

Produktkod. 18273188 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
0.1 mL
Förpackningsstorlek:
0.1ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet unitSize
18273188 0.1 mL 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18273188 Leverantör Novus Biologicals Leverantörsnummer NBP190688

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody

TOMM6 Polyclonal specifically detects TOMM6 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen TOMM6
Användningsområden Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Klassificering Polyclonal
Konjugera Unconjugated
Utspädning Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:10-1:20
Formulering PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias FLJ32622, mitochondrial import receptor subunit TOM6 homolog, over-expressed breast tumor protein, TOM6, translocase of outer membrane 6 kDa subunit homolog, translocase of outer mitochondrial membrane 6 homolog (yeast)
Gensymboler TOMM6
Värd art Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAPQ
Reningsmetod Affinity Purified
Kvantitet 0.1 mL
Regulatorisk status RUO
Primär eller sekundär Primary
Gen-ID (Entrez) 100188893
Testspecificitet Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Målarter Human
Innehåll och lagring Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotyp IgG
Visa mer Visa mindre

For Research Use Only

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.