missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
TOMM6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-90688
Denna artikel kan inte returneras.
Se returpolicy
Beskrivning
TOMM6 Polyclonal specifically detects TOMM6 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifikationer
| TOMM6 | |
| Polyclonal | |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:10-1:20 | |
| FLJ32622, mitochondrial import receptor subunit TOM6 homolog, over-expressed breast tumor protein, TOM6, translocase of outer membrane 6 kDa subunit homolog, translocase of outer mitochondrial membrane 6 homolog (yeast) | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 100188893 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| TOMM6 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAPQ | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering