missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. TTC18 Antibody, Novus Biologicals™

TTC18 Antibody, Novus Biologicals™

Produktkod. 18612428 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μg
25 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
18612428 25 μL
18647836 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18612428 Leverantör Novus Biologicals Leverantörsnummer NBP26266825ul
  • ONLINE EXCLUSIVE PRICE
    4441.54 SEK
    3748.50 SEK / 25µL
    Save 693.04 SEK
    15% Av
 Begränsad artikel
Beräknad leverans: 01-12-2026
Lägg i varukorgen
Lägg i varukorgen

missing translation for 'validMainframeMsg'

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody

TTC18 Polyclonal specifically detects TTC18 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin).
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen TTC18
Användningsområden Immunohistochemistry, Immunohistochemistry (Paraffin)
Klassificering Polyclonal
Konjugera Unconjugated
Utspädning Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulering PBS (pH 7.2) and 40% Glycerol
Gene Alias FLJ12173, FLJ25765, RP11-152N13.6, tetratricopeptide repeat domain 18, tetratricopeptide repeat protein 18, tetratricopeptide repeat-containing protein, TPR repeat protein 18
Värd art Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: DLKGFKGDTPVTFIRAEFNQVVLGDSAKITVSPEGSAKYNFTSSFEFNPEGGITSDDLAHKPVFLTVTEVLPKEKKQKE
Reningsmetod Protein A purified
Kvantitet 25 μL
Regulatorisk status RUO
Primär eller sekundär Primary
Gen-ID (Entrez) 118491
Målarter Human
Innehåll och lagring Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Produkttyp Antibody
Form Purified
Isotyp IgG
Produktlinje Novus
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.