missing translation for 'onlineSavingsMsg'
Learn More

UBE2H Recombinant Protein, Abnova

Brand:  Abnova H00007328-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16181692

  • 3343.96 SEK / 10µg

Estimated Shipment: 06-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Specifications

AAH06277
Solution
7328
UBE2H (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
UBE2H
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
46.2
8
Glutathione Sepharose 4 Fast Flow
10 ug
MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL
E2-20K/UBC8/UBCH/UBCH2
UBE2H
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates