missing translation for 'onlineSavingsMsg'
Learn More

UBXN1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-17958-25UL

Product Code. 18322795

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

UBXN1 Polyclonal antibody specifically detects UBXN1 in Human samples. It is validated for Western Blot, Immunofluorescence

Specifications

Antigen	UBXN1
Classification	Polyclonal
Dilution	Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Gene Alias	2B28, LOC51035, SAKS1UBA/UBX 33.3 kDa protein, SAPK substrate protein 1, UBX domain protein 1, UBX domain-containing protein 1, UBXD10
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: KAEELAARQRVREKIERDKAERAKKYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKREYDQCRIQVRLPDG
Quantity	25 μg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Western Blot, Immunofluorescence
Conjugate	Unconjugated
Formulation	PBS, pH 7.2, 40% glycerol
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	51035
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Product Suggestions

Description