missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. UNC119B Rabbit anti-Human, Polyclonal, Novus Biologicals™

UNC119B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Produktkod. 18393304 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
18393304 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18393304 Leverantör Novus Biologicals Leverantörsnummer NBP317146100UL

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody

UNC119B Polyclonal antibody specifically detects UNC119B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen UNC119B
Användningsområden Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Klassificering Polyclonal
Konjugera Unconjugated
Utspädning Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulering PBS, pH 7.2, 40% glycerol
Gene Alias POC7 centriolar protein homolog B, POC7B, unc119 homolog B, unc-119 homolog B (C. elegans)
Värd art Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: IRDLETGTVLFEIAKPCVSDQEEDEEEGGGDVDISAGR
Reningsmetod Affinity purified
Kvantitet 100 μg
Regulatorisk status RUO
Forskningsdisciplin Proteases & Other Enzymes
Primär eller sekundär Primary
Gen-ID (Entrez) 84747
Målarter Human
Innehåll och lagring Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotyp IgG
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.