missing translation for 'onlineSavingsMsg'
Learn More
Learn More
USP35 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-09379-100UL
This item is not returnable.
View return policy
Description
USP35 Polyclonal specifically detects USP35 in Human samples. It is validated for Western Blot.Specifications
USP35 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Deubiquitinating enzyme 35, EC 3.4.19.12, KIAA1372, ubiquitin carboxyl-terminal hydrolase 35, ubiquitin specific peptidase 35, ubiquitin specific protease 35, ubiquitin thioesterase 35, Ubiquitin thiolesterase 35, Ubiquitin-specific-processing protease 35, USP34 | |
The immunogen is a synthetic peptide directed towards the C terminal region of human USP35 (NP_065849). Peptide sequence MEAISKDNILYLQEQEKEARSRAAYISALPTSPHWGRGFDEDKDEDEGSP | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
57558 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |