missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. VSIG10 Antibody, R&D Systems™

VSIG10 Antibody, R&D Systems™

Produktkod. 18606277 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μg
25 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
18606277 100 μg
18650369 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18606277 Leverantör Novus Biologicals Leverantörsnummer NBP268783
  • ONLINE EXCLUSIVE PRICE
    6067.01 SEK
    5634.30 SEK / 100µL
    Save 432.71 SEK
    7% Av
 Begränsad artikel
Beräknad leverans: 02-12-2026
Lägg i varukorgen
Lägg i varukorgen

missing translation for 'validMainframeMsg'

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

VSIG10 Polyclonal antibody specifically detects VSIG10 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen VSIG10
Användningsområden Immunofluorescence
Klassificering Polyclonal
Konjugera Unconjugated
Utspädning Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Formulering PBS (pH 7.2) and 40% Glycerol
Gene Alias FLJ20674, V-set and immunoglobulin domain containing 10, V-set and immunoglobulin domain-containing protein 10
Värd art Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LTCQVSGAYPPAKILWLRNLTQPEVIIQPSSRHLITQDGQNSTLTIHNCSQDLDEGYYICRADSPVGVREMEIWLSVK
Reningsmetod Protein A purified
Kvantitet 100 μg
Regulatorisk status RUO
Primär eller sekundär Primary
Gen-ID (Entrez) 54621
Målarter Human
Innehåll och lagring Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Produkttyp Antibody
Form Purified
Isotyp IgG
Produktlinje Novus
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.