missing translation for 'onlineSavingsMsg'
Learn More

VSTM2B Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-10212-100UL

Product Code. 18323964

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

VSTM2B Polyclonal specifically detects VSTM2B in Mouse samples. It is validated for Western Blot.

Specifications

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS buffer, 2% sucrose
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of mouse VSTM2B (NP_067362.1). Peptide sequence SHRLRLSAVRLQDEGVYECRVSDYSDDDTQEHKAQALLRVLSRFAPPNMQ
Quantity	100 μg
Primary or Secondary	Primary
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Description